Otk-expert.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title OTK-Expert : Le Magazine des Meilleurs Duellistes Yu-Gi-Oh!
Description Le Magazine des Meilleurs Duellistes : Yu Gi Oh, Wakfu... L'actualité, les decks commentés, les combos, les analyses, les reportages, ...
Keywords oteka, magazine, mag, yu gi oh, yugioh, wakfu, JCC, autres jeux, actus, decks commentes, combos, technique, analyses, initiation, reportages, univers, portraits, focus, astuces, deck-building, playtest
Server Information
WebSite otk-expert favicon www.otk-expert.com
Host IP 37.59.46.109
Location France
Related Websites
Site Rank
otk-expert.fr #471,356
lotusnoir.info #3,915,064
finalyugi.com #7,713,558
ultrajeux.com #748,704
More to Explore
otoboyasizgocukduzeltme.com
otomatikkepenktamiriaydinefeler.wordpress.com
otpusk21.ru
overboard.eu
overboard.sg
packcenter.info
paimosubroto.blogspot.com
pak-shoo.com
palmvalleyoutdoors.com
pandahali.com
nlightvc.com
nkinter.co.jp
Otk-expert.com Valuation
US$1,469
Last updated: Dec 19, 2019

Otk-expert.com has global traffic rank of 11,443,982. Otk-expert.com has an estimated worth of US$ 1,469, based on its estimated Ads revenue. Otk-expert.com receives approximately 268 unique visitors each day. Its web server is located in France, with IP address 37.59.46.109. According to SiteAdvisor, otk-expert.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$1,469
Daily Ads Revenue US$0
Monthly Ads Revenue US$24
Yearly Ads Revenue US$293
Daily Unique Visitors 268
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 11,443,982
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
otk-expert.com A 21599 IP: 37.59.46.109
otk-expert.com MX 21599 Priority: 1
Target: redirect.ovh.net.
otk-expert.com NS 21599 Target: ns20.ovh.net.
otk-expert.com NS 21599 Target: dns20.ovh.net.
otk-expert.com SOA 21599 MNAME: dns20.ovh.net.
RNAME: tech.ovh.net.
Serial: 2016030800
Refresh: 86400
Retry: 3600
Expire: 3600000
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 200 OK
Date: Thu, 19 Dec 2019 14:37:41 GMT
Server: Apache/2.4.38 (Debian)
Set-Cookie: PHPSESSID=efkfs10ju86fg99bh0edqvqn90; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link: <http://otk-expert.com/wp-json/>; rel="https://api.w.org/"
Link: <http://otk-expert.com/>; rel=shortlink
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Otk-expert.com Whois Information
   Domain Name: OTK-EXPERT.COM
   Registry Domain ID: 1686481676_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.ovh.com
   Registrar URL: http://www.ovh.com
   Updated Date: 2019-11-01T20:41:25Z
   Creation Date: 2011-11-10T11:31:12Z
   Registry Expiry Date: 2020-11-10T11:31:12Z
   Registrar: OVH sas
   Registrar IANA ID: 433
   Registrar Abuse Contact Email: abuse@ovh.net
   Registrar Abuse Contact Phone: +33.972101007
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: DNS20.OVH.NET
   Name Server: NS20.OVH.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: otk-expert.com
Registry Domain ID: 1686481676_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: https://www.ovh.com
Updated Date: 2019-11-01T19:41:25.0Z
Creation Date: 2011-11-10T10:31:12.0Z
Registrar Registration Expiration Date: 2020-11-10T10:31:12.0Z
Registrar: OVH, SAS
Registrar IANA ID: 433
Registrar Abuse Contact Email: abuse@ovh.net
Registrar Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:  
Registrant Organization: 
Registrant Street: 
Registrant City: 
Registrant State/Province: 
Registrant Postal Code: 
Registrant Country: FR
Registrant Phone: 
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: sctur0rli04aaol5hii5@k.o-w-o.info
Registry Admin ID:
Admin Name:  
Admin Organization: 
Admin Street: 
Admin City: 
Admin State/Province: 
Admin Postal Code: 
Admin Country: 
Admin Phone: 
Admin Phone Ext:
Admin Fax: 
Admin Fax Ext:
Admin Email: 84i304kppp5r8mz8rylp@p.o-w-o.info
Registry Tech ID:
Tech Name:  
Tech Organization: 
Tech Street: 
Tech City: 
Tech State/Province: 
Tech Postal Code: 
Tech Country: 
Tech Phone: 
Tech Phone Ext:
Tech Fax: 
Tech Fax Ext:
Tech Email: 84i304kppp5r8mz8rylp@p.o-w-o.info
Name Server: ns20.ovh.net
Name Server: dns20.ovh.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/